Freeze-thaw is one of those subjects where the details matter more than the headlines. This page pulls together the background, the mechanisms, and the practical points readers ask about most.
Last reviewed on 2025-12-17. Where a claim depends on a specific study, the study is described rather than over-claimed.
The peer-reviewed record is dominated by small early-phase studies, case reports and pharmacovigilance summaries rather than large randomised trials. Papers typically examine tanning response, receptor selectivity or patterns of reported adverse events. Many note that participants obtained the peptide outside a clinical setting, which limits verification of composition and administered amount. Reported events vary widely, and causality is frequently unclear because the identity and purity of self-sourced material are unknown. Open questions include whether repeated melanocortin receptor stimulation produces cumulative effects, and how often label claims match actual content.
Identification in laboratories relies on reversed-phase liquid chromatography coupled with tandem mass spectrometry, with product-ion spectra compared against a certified reference standard. High-resolution mass spectrometry supplies accurate mass confirmation, and peptide mapping after enzymatic digestion separates melanotan II from closely related analogues. Quantitation of seized material is complicated by unknown counter-ions and residual trifluoroacetate left from purification. Immunoassays raised against alpha-melanocyte-stimulating hormone can cross-react, so chromatographic confirmation is normally required. Urinary detection windows are short, and reported limits of detection differ substantially between laboratories.
Identity testing for a cyclic peptide of this size usually relies on reversed-phase high-performance liquid chromatography coupled to mass spectrometry. The mass spectrum confirms molecular weight, while the chromatographic trace indicates the proportion of related impurities. Tandem mass spectrometry can provide sequence-level information when fragmentation data are compared against a reference standard. Nuclear magnetic resonance is sometimes used to confirm the lactam bridge, although it requires more material and greater operator expertise than routine chromatographic methods.
Lyophilised peptide powder is comparatively stable when kept dry, cold and protected from light. Once dissolved, the molecule is exposed to hydrolysis, oxidation and microbial growth, and degradation accelerates at higher temperatures and in alkaline solution. Repeated freeze-thaw cycles concentrate solutes and promote aggregation. Handling guidance for research peptides commonly clusters around freezer temperatures for powder and short refrigerated use for reconstituted solutions, with pH control and sterile technique applied throughout.
Verification of a purchased sample requires documentation linking a batch to a certificate of analysis, and that document should be read for the methods used rather than the headline purity figure. A single chromatographic percentage does not establish identity. Independent laboratories can perform identity and content assays, but no such test establishes that a product is suitable for human use. Claims about efficacy rest largely on small, early studies rather than on replicated controlled trials, and that gap remains open.
| Property | Value | Notes |
|---|---|---|
| Regulatory status | Unapproved in the US, EU and Australia | Sale and import restricted; no licensed product |
| Typical test matrices | Urine, serum, seized powder | Urinary detection window is short |
| Primary identification method | LC-MS/MS against a reference standard | High-resolution mass used for confirmation |
| Data sources in the literature | Small trials, case reports, pharmacovigilance | No registrational trial dataset exists |
| Common marketing names | Melanotan 2, MT-II, MT-2 | Label content may not match declared peptide |
Identity and purity are assessed with chromatographic and mass spectrometric techniques. Reversed-phase high-performance liquid chromatography separates the target peptide from related impurities and degradation products, and the resulting retention time is compared against a reference standard. Mass spectrometry, often coupled to liquid chromatography, confirms molecular mass. Amino acid analysis or peptide mapping can provide additional sequence-level confirmation when required. Results are only as reliable as the reference materials used alongside them.
Regulatory treatment varies by country. In the United States, melanotan-2 is not approved for any indication, and products marketed for human use fall outside the approved drug framework. Some other jurisdictions have placed it under prescription controls or listed it as a prohibited or restricted substance. Online listings frequently describe the material as a research chemical, a category that does not carry the same manufacturing and labelling requirements as approved medicines.
Solid peptide material is generally stable when kept cold and dry. Common practice is storage at -20 degrees Celsius or lower, with desiccant and protection from light. Repeated freeze-thaw cycles and exposure to moisture are associated with degradation, aggregation, or loss of material. Once dissolved, stability depends on solvent, concentration, and temperature, and solutions are usually treated as short-lived unless stability data support longer periods. Handling notes typically emphasise minimising time at ambient temperature.
Reported observations after unregulated use include shifts in skin pigmentation and, in some accounts, unintended changes to moles and other lesions. Whether these outcomes are causally linked to the compound, and how often they occur, remain open questions because controlled data are scarce. The absence of standardised dosing and verified product purity complicates interpretation. Researchers have called for better surveillance and analytical characterisation of samples obtained outside regulated channels. Conclusions drawn from anecdotal evidence should be treated as provisional.
Melanotan-2 has not received marketing authorisation from major regulatory agencies for any therapeutic indication. Several jurisdictions classify it as a prescription-only medicine or a controlled substance when supplied for human use. Because approved products do not exist, material sold online usually sits outside pharmaceutical supply chains and formal quality oversight. Regulators have issued public notices describing the compound as unapproved. Enforcement varies, and the legal position differs between countries, which complicates any single general statement about its status.
Scientific discussion of Melanotan-2 spans pharmacology, dermatology, and public-health literature. Laboratory studies examine its receptor binding and cellular effects, while clinical reports describe outcomes observed after unregulated use. These two bodies of work differ in rigour and intent. Peer-reviewed trials of the compound as a medicine are limited, so much of the available information comes from case reports and surveillance data. Authors frequently note the gap between experimental findings and real-world use.
The kidney is a vital organ with a variety of responsibilities. It plays an important role in maintaining the water, electrolyte and acid-base balance. It excretes toxic metabolic degradation products such as urea. It also recovers valuable substances such as glucose, amino acids, peptides and minerals initially filtered out of the blood during ultrafiltration in the renal corpuscles. In addition, endogenous and exogenous substances are metabolized and broken down in the kidneys—the kidney is therefore a central metabolic organ alongside the liver. Finally, some hormone-active substances are secreted by the kidney, such as renin, erythropoietin and calcitriol (active form of vitamin D3). As a result, the organ plays an important role in the regulation of blood pressure, new blood formation and the balance of calcium and phosphorus, and is thus crucial to bone metabolism, as well. As carnivores, cats are particularly dependent on the intake of animal proteins because glucose formation from amino acids is their most important energy source. The enzymes of amino acid degradation are adapted to the high protein intake and their activity is largely independent of the protein supply in the diet, so that cats break down endogenous proteins (especially from the muscles) when there is a lack of protein intake (catabolic metabolic state). Meat and offal also contain vital nutrients for the cat, such as Vitamin A, Taurin or arachidonic acid. Compared to a normal human diet, cats consume around six times as much phosphate in their diet with standard cat food.
Cecropin A Peptide Sequence (KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK). Secondary structure includes two α helices. At low peptide to lipid ratios ion channels are formed, at high peptide to lipid ratios pores are formed. Cecropin B Peptide Sequence (KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL). Secondary structure includes two α helices. CECD from Aedes aegypti (Yellowfever mosquito). Papiliocin from Papilio xuthus (a butterfly) Cecropin P1 Peptide Sequence (SWLSKTAKKLENSAKKRISEGIAIAIQGGPR). An antibacterial peptide from Ascaris suum, a parasitic nematode that resides in the pig intestine, also belongs to this family.
Shut-down separator (for overheating) Tear-away tab (for internal pressure relief) Vent (pressure relief in case of severe outgassing) Thermal interrupt (overcurrent/overcharging/environmental exposure) These features are required because the negative electrode produces heat during use, while the positive electrode may produce oxygen. However, these additional devices occupy space inside the cells, add points of failure, and may irreversibly disable the cell when activated. Further, these features increase costs compared to nickel metal hydride batteries, which require only a hydrogen/oxygen recombination device and a back-up pressure valve. Contaminants inside the cells can defeat these safety devices. Also, these features cannot be applied to all kinds of cells; prismatic high-current cells cannot be equipped with a vent or thermal interrupt. High-current cells must not produce excessive heat or oxygen, lest there be a failure, possibly violent. Instead, they must be equipped with internal thermal fuses which act before the anode and cathode reach their thermal limits. Replacing the lithium cobalt oxide positive electrode material with a lithium metal phosphate such as lithium iron phosphate (LFP) improves cycle counts, shelf life and safety, but lowers capacity. As of 2006, these safer lithium-ion batteries were mainly used in electric cars and other large-capacity battery applications, where safety is critical. In 2016, an LFP-based energy storage system was chosen to be installed in Paiyun Lodge on Mt.Jade (Yushan) (the highest lodge in Taiwan).
Sources: en.wikipedia.org
Four-time finance minister and Sharif family associate Ishaq Dar would drop out the race for the position of Minister of Finance & Revenue. According to the Tribune, an anonymous PML-N leader claimed that the appointment of Mohsin Naqvi as Interior Minister would "erode the government's credibility", according to another anonymous PML-N leader, Ishaq Dar was not chosen due to the PM's preference for a new Finance minister. Prior to the inauguration of the Federal Cabinet, the International Monetary Fund (IMF) reportedly tied cabinet formation as a pre-condition for the sending of an IMF team to Pakistan to negotiate and finalize another bailout from the Fund. On March 11 President Asif Ali Zardari administered the oath to the PM's 19-member federal cabinet. The proposals for appointment was made under clause 1 of Article 92 (federal ministers and ministers of state) of the Constitution. On the same day Muhammad Aurangzeb, the new finance minister would renounce his Dutch nationality and be granted Pakistani nationality as well as resign from his position as CEO of Habib Bank Limited. The nineteen member cabinet includes many veteran politicians and newcomers. Mohsin Naqvi and Ahad Cheema, former caretaker ministers would be included amongst other PML-N stalwarts. The swearing-in ceremony was held in the President's House (Aiwan-i-Sadr). On March 12 the new Federal cabinet members assumed charge after allocation of their portfolios.
In biology and biochemistry, the active site is the region of an enzyme where substrate molecules bind and undergo a chemical reaction. The active site consists of amino acid residues that form temporary bonds with the substrate, the binding site, and residues that catalyse a reaction of that substrate, the catalytic site. Although the active site occupies only ~10–20% of the volume of an enzyme, it is the most important part as it directly catalyzes the chemical reaction. It usually consists of three to four amino acids, while other amino acids within the protein are required to maintain the tertiary structure of the enzymes. Each active site is evolved to be optimised to bind a particular substrate and catalyse a particular reaction, resulting in high specificity. This specificity is determined by the arrangement of amino acids within the active site and the structure of the substrates. Sometimes enzymes also need to bind with some cofactors to fulfil their function. The active site is usually a groove or pocket of the enzyme which can be located in a deep tunnel within the enzyme, or between the interfaces of multimeric enzymes. An active site can catalyse a reaction repeatedly as residues are not altered at the end of the reaction (they may change during the reaction, but are regenerated by the end). This process is achieved by lowering the activation energy of the reaction, so more substrates have enough energy to undergo reaction.
== Industrial functionality == A number of halogenated compounds are environmentally toxic industrial by-products, and it has been suggested that haloalkane dehalogenases may be useful catalysts for their biodegradation, with potential applications in bioremediation. In biocatalysis, there is a standing interest in these enzymes, particularly for the production of optically pure alcohols. Therefore, the identification of dehalogenating enzymes with appropriate selectivity patterns is very important in terms of their industrial utility.
where j is the James–Martin pressure drop correction, m is the sample mass, F is the carrier gas flow rate at standard temperature and pressure, tR is the gross retention time for the injected probe, to is the retention time for a non-interaction probe (i.e. dead-time), and T is the absolute temperature.
Sources: en.wikipedia.org
Briton Callum Tindal-Draper is killed while fighting with the 4th International Legion in Ukraine. 6 November – At Newcastle Crown Court, former GP Thomas Kwan is sentenced to 31 years in prison after posing as a community nurse to inject his mother's partner with a substance that caused him to contract a flesh eating disease following a row over inheritance. 7 November The Bank of England cuts the UK interest rate by 0.25% to 4.75%, but indicates further cuts may take longer than previously thought following the October budget, which it forecasts will lead to price increases. Argentinian authorities announce that three people have been charged in connection with the death of One Direction's Liam Payne. A report into more than 100 allegations of sexual abuse against barrister John Smyth QC, who died in 2018, finds his activities were covered up by the Church of England for several decades. Smyth used his home as a Christian summer camp during the 1970s and 1980s, when the abuse of boys and young men is thought to have happened. The Football Association opens a safeguarding inquiry into a Premiership club official following sexual allegations made by three women. The charity organisation Care England estimates that as a result of the increase in employers' National Insurance contributions and the national minimum wage in the recent budget, that the cost of providing care will increase by over £3,000 per person and that the increases are expected to be passed on to care home residents and their relatives.
== Diagnosis == The only reliable way to determine whether a soft-tissue tumor is benign or malignant is through a biopsy. The two methods for acquisition of tumor tissue for cytopathological analysis are:
==== Refeeding syndrome ==== When a malnourished person is refed too quickly, they may develop refeeding syndrome (RFS), which can be life-threatening. Factors associated with increased risk for RFS include:
Boletus edulis, as the species epithet edulis (Latin: edible) indicates, is an edible mushroom. Italian chef and restaurateur Antonio Carluccio described it as representing "the wild mushroom par excellence", and hailed it as the most rewarding of all fungi in the kitchen for its taste and versatility. Considered a choice edible, particularly in France, Germany, Poland and Italy, it was widely written about by the Roman writers Pliny the Elder and Martial, although ranked below the esteemed Amanita caesarea. When he was served suilli instead of boleti, the disgruntled Martial wrote: sunt tibi boleti; fungos ego sumo suillos (Ep. iii. 60)("You eat the choice boletus, I have mushrooms that swine grub up.") The flavour of porcini has been described as nutty and slightly meaty, with a smooth, creamy texture, and a distinctive aroma reminiscent of sourdough. Young, small porcini are most appreciated, as the large ones often harbour maggots (insect larvae), and become slimy, soft and less tasty with age. The fruit bodies are collected by holding the stipe near the base and twisting gently. Cutting the stipe with a knife may risk the part left behind rotting and the mycelium being destroyed. Peeling and washing are not recommended. The fruit bodies are highly perishable, due largely to the high water content (around 90%), the high level of enzyme activity, and the presence of a flora of microorganisms.
History of flow chemistry – history of chemical reactions run in a continuously flowing stream rather than in batch production. History of geochemistry – history of the study of the mechanisms behind major geological systems using chemistry History of aqueous geochemistry – history of the study of the role of various elements in watersheds, including copper, sulfur, mercury, and how elemental fluxes are exchanged through atmospheric-terrestrial-aquatic interactions History of isotope geochemistry – history of the study of the relative and absolute concentrations of the elements and their isotopes using chemistry and geology History of ocean chemistry – history of the study the chemistry of marine environments, including the influences of different variables. History of organic geochemistry – history of the study of the impacts and processes that organisms have had on Earth History of regional, environmental and exploration geochemistry – history of the study of the spatial variation in the chemical composition of materials at the surface of the Earth History of inorganic chemistry – history of the branch of chemistry concerned with the properties and behavior of inorganic compounds. History of nuclear chemistry – history of the subfield of chemistry dealing with radioactivity, nuclear processes and nuclear properties.
Sources: en.wikipedia.org
Regulatory treatment varies by country. In the United States, the European Union and Australia it is an unapproved drug and its sale is restricted, while some other jurisdictions list it as prescription-only or controlled. The applicable rules depend on the country of import.
Reversed-phase LC-MS/MS is the usual approach for both identification and quantitation. High-resolution mass spectrometry and peptide mapping serve as confirmatory methods. Immunoassays are rarely used alone because of cross-reactivity.
Published testing of seized and purchased samples frequently reports discrepancies between declared and measured peptide content. Counter-ion content and residual solvents add further variation. Independent analysis is the only way to confirm composition.
Mass spectrometry combined with liquid chromatography provides both molecular weight confirmation and a measure of related impurities. Tandem mass spectrometry adds sequence information. A purity percentage reported without a mass measurement does not confirm what the material is.